PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0216s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 834aa    MW: 91213.4 Da    PI: 6.9272
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0216s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-096436801954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  SapurV1A.0216s0040.1.p 643 FEHflHPYPTDADKHMLATQTGLSRNQVSNWFINARVR 680
                             554459******************************88 PP

2BELL92.25e-30499567472
                    BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             e+q+ kakLl l +eV++rYkqy++q+q v++sFe vagl +a+pY++lAlk++S +F++Lk ai++++
  SapurV1A.0216s0040.1.p 499 EHQQMKAKLLFLEDEVCRRYKQYHQQMQKVAASFESVAGLSAATPYVTLALKTVSGNFKSLKHAISDHL 567
                             79999************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.2E-35398565IPR006563POX domain
PfamPF075261.5E-34403564IPR006563POX domain
PROSITE profilePS5007111.985621684IPR001356Homeobox domain
SMARTSM003891.6E-9624688IPR001356Homeobox domain
CDDcd000863.58E-12624685No hitNo description
SuperFamilySSF466891.2E-16626689IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-27627688IPR009057Homeodomain-like
PfamPF059201.9E-18641680IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MDTRNLRPDS HVAQQSRRDK LRVQQGLSSV QHIDEFPGCL EHYSIRPGLS PDLVHVRNFR  60
NGSMLYDSPM FSSEMLNFAT SSHAVSASKD AIVGQELGPI PAENSSFTSI SHPVLSNFNA  120
SPKPTTCDPQ ECVNWRSLDP QQSYDLMVNY AGGSVGGERN QKPMFVGEVL SNNARSSNIS  180
TSRQYWMPSY VENQDVQLPS TLRNSSGEIL SDDHSLKEAR EMQITSLPPY QNTLLDVIPS  240
GCFRPRINER IVHPSYATES TPSDLDNNTG TWMSRSLENH HHWSGELGLI ARTSDQDLRT  300
IGSDANTQGL SLSLSSINPP SKVEVTHFGE GCASEHLQLK EARVSQESHQ DSKISKSSSF  360
CAMPKPSIIS KGGGKSLHDI VGTSTHAFRN TGPLGPFTGY AAILKSSGFL KPAQELLEEF  420
SSLTGPKLMR TSEMFDRISG DQVNALAMAD TVNPVDEEGG TKGNDFPGIS SSTFYSLNKR  480
SGSAGVGGSG SSCGSYGPEH QQMKAKLLFL EDEVCRRYKQ YHQQMQKVAA SFESVAGLSA  540
ATPYVTLALK TVSGNFKSLK HAISDHLKQV TKAVGDNLFY RNAAAAGSKA DTSTSRLRYM  600
DQSIQTSKSA GVNVGYHEPQ QHIWRPQRGL PERSVAVLRA WLFEHFLHPY PTDADKHMLA  660
TQTGLSRNQV SNWFINARVR LWKPMVEEIH LLESKGLGEK AGKNDGDSAE GNSQSNDEEG  720
SNKFGTNSVL NKQMECSGIG SSGGSDEQQD AEQFSREKRS KVEFQVPTTM DGSPMNFLPY  780
QRSGTDNGGL GAVSLTLGLR QGIESAQHQI QLQQHKGHFK QPFGGQMIHD FVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-15630687158Homeobox protein Meis1
4xrs_B1e-15630687158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011040912.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_011040913.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLB9HQD00.0B9HQD0_POPTR; Homeodomain-containing family protein
STRINGPOPTR_0009s01520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.16e-92BEL1-like homeodomain 8